Lineage for d2giua1 (2giu A:260-497)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 647844Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 647845Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 647846Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (32 proteins)
  6. 647938Protein Estrogen receptor beta [48521] (2 species)
  7. 647939Species Human (Homo sapiens) [TaxId:9606] [48522] (15 PDB entries)
  8. 647953Domain d2giua1: 2giu A:260-497 [135252]
    automatically matched to d1l2jb_
    complexed with fbr

Details for d2giua1

PDB Entry: 2giu (more details), 2.2 Å

PDB Description: human estrogen receptor beta ligand-binding domain in complex with compound 45
PDB Compounds: (A:) Estrogen receptor beta

SCOP Domain Sequences for d2giua1:

Sequence, based on SEQRES records: (download)

>d2giua1 a.123.1.1 (A:260-497) Estrogen receptor beta {Human (Homo sapiens) [TaxId: 9606]}
ldalspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgf
velslfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdm
llattsrfrelklqhkeylcvkamillnssmyplvtatqdadssrklahllnavtdalvw
viaksgissqqqsmrlanllmllshvrhasnkgmehllnmkcknvvpvydlllemlna

Sequence, based on observed residues (ATOM records): (download)

>d2giua1 a.123.1.1 (A:260-497) Estrogen receptor beta {Human (Homo sapiens) [TaxId: 9606]}
ldalspeqlvltlleaepphvlisrpasmmmsltkladkelvhmiswakkipgfvelslf
dqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcegileifdmllattsr
frelklqhkeylcvkamillnssmyplvadssrklahllnavtdalvwviaksgissqqq
smrlanllmllshvrhasnkgmehllnmvvpvydlllemlna

SCOP Domain Coordinates for d2giua1:

Click to download the PDB-style file with coordinates for d2giua1.
(The format of our PDB-style files is described here.)

Timeline for d2giua1: