Class b: All beta proteins [48724] (165 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (7 families) contains copper-binding site |
Family b.6.1.1: Plastocyanin/azurin-like [49504] (9 proteins) mono-domain proteins |
Protein Plastocyanin [49507] (14 species) |
Species Anabaena variabilis [TaxId:1172] [49517] (5 PDB entries) |
Domain d2gimc1: 2gim C:1-105 [135245] automatically matched to d1fa4a_ complexed with cu |
PDB Entry: 2gim (more details), 1.6 Å
SCOP Domain Sequences for d2gimc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gimc1 b.6.1.1 (C:1-105) Plastocyanin {Anabaena variabilis [TaxId: 1172]} etytvklgsdkgllvfepakltikpgdtveflnnkvpphnvvfdaalnpaksadlaksls hkqllmspgqststtfpadapageytfycephrgagmvgkitvag
Timeline for d2gimc1: