Lineage for d2gimc_ (2gim C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2770400Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2770828Protein Plastocyanin [49507] (17 species)
  7. 2770829Species Anabaena variabilis [TaxId:1172] [49517] (4 PDB entries)
  8. 2770831Domain d2gimc_: 2gim C: [135245]
    automated match to d1fa4a_
    complexed with cu

Details for d2gimc_

PDB Entry: 2gim (more details), 1.6 Å

PDB Description: 1.6 angstrom structure of plastocyanin from anabaena variabilis
PDB Compounds: (C:) plastocyanin

SCOPe Domain Sequences for d2gimc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gimc_ b.6.1.1 (C:) Plastocyanin {Anabaena variabilis [TaxId: 1172]}
metytvklgsdkgllvfepakltikpgdtveflnnkvpphnvvfdaalnpaksadlaksl
shkqllmspgqststtfpadapageytfycephrgagmvgkitvag

SCOPe Domain Coordinates for d2gimc_:

Click to download the PDB-style file with coordinates for d2gimc_.
(The format of our PDB-style files is described here.)

Timeline for d2gimc_: