Lineage for d2giec1 (2gie C:2-258)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 700831Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 700832Superfamily c.52.1: Restriction endonuclease-like [52980] (31 families) (S)
  5. 701047Family c.52.1.19: Restriction endonuclease HincII [69525] (1 protein)
  6. 701048Protein Restriction endonuclease HincII [69526] (1 species)
  7. 701049Species Haemophilus influenzae [TaxId:727] [69527] (6 PDB entries)
  8. 701068Domain d2giec1: 2gie C:2-258 [135242]
    automatically matched to d1kc6a_
    complexed with na

Details for d2giec1

PDB Entry: 2gie (more details), 2.6 Å

PDB Description: hincii bound to cognate dna gttaac
PDB Compounds: (C:) Type II restriction enzyme HincII

SCOP Domain Sequences for d2giec1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2giec1 c.52.1.19 (C:2-258) Restriction endonuclease HincII {Haemophilus influenzae [TaxId: 727]}
sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
aismidkfvkpfkkyil

SCOP Domain Coordinates for d2giec1:

Click to download the PDB-style file with coordinates for d2giec1.
(The format of our PDB-style files is described here.)

Timeline for d2giec1: