Lineage for d2gieb_ (2gie B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2882263Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2882264Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2882542Family c.52.1.19: Restriction endonuclease HincII [69525] (1 protein)
    automatically mapped to Pfam PF09226
  6. 2882543Protein Restriction endonuclease HincII [69526] (1 species)
  7. 2882544Species Haemophilus influenzae [TaxId:727] [69527] (19 PDB entries)
    Uniprot P17743 ! Uniprot P44413
  8. 2882577Domain d2gieb_: 2gie B: [135241]
    automated match to d1kc6a_
    protein/DNA complex; complexed with na

Details for d2gieb_

PDB Entry: 2gie (more details), 2.6 Å

PDB Description: hincii bound to cognate dna gttaac
PDB Compounds: (B:) Type II restriction enzyme HincII

SCOPe Domain Sequences for d2gieb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gieb_ c.52.1.19 (B:) Restriction endonuclease HincII {Haemophilus influenzae [TaxId: 727]}
sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
aismidkfvkpfkkyi

SCOPe Domain Coordinates for d2gieb_:

Click to download the PDB-style file with coordinates for d2gieb_.
(The format of our PDB-style files is described here.)

Timeline for d2gieb_: