SCOPe 2.08: Domain d2giea_: 2gie A:

Lineage for d2giea_ (2gie A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families)

5. Family c.52.1.19: Restriction endonuclease HincII [69525] (1 protein)
   automatically mapped to Pfam PF09226

6. Protein Restriction endonuclease HincII [69526] (1 species)

7. Species Haemophilus influenzae [TaxId:727] [69527] (19 PDB entries)
   Uniprot P17743 ! Uniprot P44413

8. Domain d2giea_: 2gie A: [135240]
   automated match to d1kc6a_
   protein/DNA complex; complexed with na

Details for d2giea_

PDB Entry: 2gie, 2.6 Å

PDB Description: hincii bound to cognate dna gttaac

PDB Compounds: (A:) Type II restriction enzyme HincII

SCOPe Domain Sequences for d2giea_:

Sequence; same for both SEQRES and ATOM records:

>d2giea_ c.52.1.19 (A:) Restriction endonuclease HincII {Haemophilus influenzae [TaxId: 727]}
sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
aismidkfvkpfkkyil

Timeline for d2giea_:

• d2giea_ first appeared in SCOP 1.73, called d2giea1
  
• d2giea_ appears in SCOPe 2.07