Lineage for d2gidj1 (2gid J:28-173)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544542Fold d.18: ssDNA-binding transcriptional regulator domain [54446] (1 superfamily)
    helix-swapped dimer of beta(4)-alpha motifs
  4. 2544543Superfamily d.18.1: ssDNA-binding transcriptional regulator domain [54447] (5 families) (S)
  5. 2544583Family d.18.1.4: Guide RNA binding protein gBP [143043] (2 proteins)
    includes PfamB PB080318 and PB073991; forms heterooligomers; similar subunit and oligomeric structures to the Plant transcriptional regulator family
    automatically mapped to Pfam PF09387
  6. 2544584Protein GBP21 [143044] (1 species)
    Mitochondrial RNA binding protein 1, MRP1
  7. 2544585Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [143045] (3 PDB entries)
    Uniprot P90629 28-173
  8. 2544590Domain d2gidj1: 2gid J:28-173 [135237]
    Other proteins in same PDB: d2gida1, d2gidg1, d2gidh1, d2gidp1
    automatically matched to 2GIA B:28-173

Details for d2gidj1

PDB Entry: 2gid (more details), 3.35 Å

PDB Description: Crystal structures of trypanosoma bruciei MRP1/MRP2
PDB Compounds: (J:) mitochondrial RNA-binding protein 1

SCOPe Domain Sequences for d2gidj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gidj1 d.18.1.4 (J:28-173) GBP21 {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
slpkfeihdvrddpaegtmtrvavdgklllisqypqlgprkvdpndlspqfdadrrisvr
lrhvdlaylvgvckervprhrmetkaytldfeksaqgyhlhgkvhrvasqrmedwsvkfd
nhfavtlehflesaldesfgfrqhya

SCOPe Domain Coordinates for d2gidj1:

Click to download the PDB-style file with coordinates for d2gidj1.
(The format of our PDB-style files is described here.)

Timeline for d2gidj1: