Lineage for d2gidg1 (2gid G:59-221)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2162927Fold d.18: ssDNA-binding transcriptional regulator domain [54446] (1 superfamily)
    helix-swapped dimer of beta(4)-alpha motifs
  4. 2162928Superfamily d.18.1: ssDNA-binding transcriptional regulator domain [54447] (5 families) (S)
  5. 2162968Family d.18.1.4: Guide RNA binding protein gBP [143043] (2 protein domains)
    includes PfamB PB080318 and PB073991; forms heterooligomers; similar subunit and oligomeric structures to the Plant transcriptional regulator family
    automatically mapped to Pfam PF09387
  6. 2162978Protein Guide RNA binding protein gBP25 [143046] (1 species)
    Mitochondrial RNA-binding protein 2, MRP2
  7. 2162979Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [143047] (2 PDB entries)
    Uniprot Q952G2 56-221
  8. 2162983Domain d2gidg1: 2gid G:59-221 [135235]
    Other proteins in same PDB: d2gidb1, d2gidd1, d2gidj1, d2gidk1
    automatically matched to 2GIA A:56-221

Details for d2gidg1

PDB Entry: 2gid (more details), 3.35 Å

PDB Description: Crystal structures of trypanosoma bruciei MRP1/MRP2
PDB Compounds: (G:) mitochondrial RNA-binding protein 2

SCOPe Domain Sequences for d2gidg1:

Sequence, based on SEQRES records: (download)

>d2gidg1 d.18.1.4 (G:59-221) Guide RNA binding protein gBP25 {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
pslaqqrarraqlppafdvvhwndedisrghllrvlhrdtfvvldyhrqarmlteegnka
ervvsvmlpavytarflavlegrsekvevhsrytnatftpnpaapytftlkctstrpaqq
kqqvageegdetfewtvefdvaeslmlqrfltqalhyntgfar

Sequence, based on observed residues (ATOM records): (download)

>d2gidg1 d.18.1.4 (G:59-221) Guide RNA binding protein gBP25 {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
pslaqqrarraqlppafdvvhwndedisrghllrvlhrdtfvvldyhrqarmlteegnka
ervvsvmlpavytarflavlegrsekvevhsrytnatftpnpaapytftlkctstrpdet
fewtvefdvaeslmlqrfltqalhyntgfar

SCOPe Domain Coordinates for d2gidg1:

Click to download the PDB-style file with coordinates for d2gidg1.
(The format of our PDB-style files is described here.)

Timeline for d2gidg1: