SCOPe 2.05: Domain d2gice_: 2gic E:

Lineage for d2gice_ (2gic E:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.260: Rhabdovirus nucleoprotein-like [140808] (1 superfamily)
   multihelical, consist of two helical domains; each domain contains a buried helix

4. Superfamily a.260.1: Rhabdovirus nucleoprotein-like [140809] (1 family)
   automatically mapped to Pfam PF00945

5. Family a.260.1.1: Rhabdovirus nucleocapsid protein [140810] (2 proteins)
   Pfam PF00945; RNA-binding homooligomeric protein

6. Protein Nucleoprotein [140811] (2 species)

7. Species Vesicular stomatitis indiana virus [TaxId:11277] [140813] (4 PDB entries)
   Uniprot P03521 2-422

8. Domain d2gice_: 2gic E: [135231]
   automated match to d2gica1
   protein/RNA complex; complexed with ium

Details for d2gice_

PDB Entry: 2gic, 2.92 Å

PDB Description: crystal structure of a vesicular stomatitis virus nucleocapsid-rna complex

PDB Compounds: (E:) nucleocapsid protein

SCOPe Domain Sequences for d2gice_:

Sequence; same for both SEQRES and ATOM records:

>d2gice_ a.260.1.1 (E:) Nucleoprotein {Vesicular stomatitis indiana virus [TaxId: 11277]}
svtvkriidntvivpklpanedpveypadyfrkskeiplyinttkslsdlrgyvyqglks
gnvsiihvnsylygalkdirgkldkdwssfginigkagdtigifdlvslkaldgvlpdgv
sdasrtsaddkwlplyllglyrvgrtqmpeyrkklmdgltnqckmineqfeplvpegrdi
fdvwgndsnytkivaavdmffhmfkkhecasfrygtivsrfkdcaalatfghlckitgms
tedvttwilnrevademvqmmlpgqeidkadsympylidfglsskspyssvknpafhfwg
qltalllrstrarnarqpddieytslttagllyayavgssadlaqqfcvgdnkytpddst
gglttnappqgrdvvewlgwfedqnrkptpdmmqyakravmslqglrektigkyaksefd
k

Timeline for d2gice_:

• d2gice_ first appeared in SCOP 1.73, called d2gice1
  
• d2gice_ appears in SCOPe 2.04
  
• d2gice_ appears in SCOPe 2.06
  
• d2gice_ appears in the current release, SCOPe 2.08