Lineage for d2gicd1 (2gic D:2-422)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 651814Fold a.260: Rhabdovirus nucleoprotein-like [140808] (1 superfamily)
    multihelical, consist of two helical domains; each domain contains a buried helix
  4. 651815Superfamily a.260.1: Rhabdovirus nucleoprotein-like [140809] (1 family) (S)
  5. 651816Family a.260.1.1: Rhabdovirus nucleocapsid protein [140810] (1 protein)
    Pfam PF00945; RNA-binding homooligomeric protein
  6. 651817Protein Nucleoprotein [140811] (2 species)
  7. 651841Species Vesicular stomatitis indiana virus [TaxId:11277] [140813] (1 PDB entry)
  8. 651845Domain d2gicd1: 2gic D:2-422 [135230]
    automatically matched to 2GIC A:2-422
    complexed with ium

Details for d2gicd1

PDB Entry: 2gic (more details), 2.92 Å

PDB Description: crystal structure of a vesicular stomatitis virus nucleocapsid-rna complex
PDB Compounds: (D:) nucleocapsid protein

SCOP Domain Sequences for d2gicd1:

Sequence, based on SEQRES records: (download)

>d2gicd1 a.260.1.1 (D:2-422) Nucleoprotein {Vesicular stomatitis indiana virus [TaxId: 11277]}
svtvkriidntvivpklpanedpveypadyfrkskeiplyinttkslsdlrgyvyqglks
gnvsiihvnsylygalkdirgkldkdwssfginigkagdtigifdlvslkaldgvlpdgv
sdasrtsaddkwlplyllglyrvgrtqmpeyrkklmdgltnqckmineqfeplvpegrdi
fdvwgndsnytkivaavdmffhmfkkhecasfrygtivsrfkdcaalatfghlckitgms
tedvttwilnrevademvqmmlpgqeidkadsympylidfglsskspyssvknpafhfwg
qltalllrstrarnarqpddieytslttagllyayavgssadlaqqfcvgdnkytpddst
gglttnappqgrdvvewlgwfedqnrkptpdmmqyakravmslqglrektigkyaksefd
k

Sequence, based on observed residues (ATOM records): (download)

>d2gicd1 a.260.1.1 (D:2-422) Nucleoprotein {Vesicular stomatitis indiana virus [TaxId: 11277]}
svtvkriidntvivpklpanedpveypadyfrkskeiplyinttkslsdlrgyvyqglks
gnvsiihvnsylygalkdirgkldkdwssfginigkagdtigifdlvslkaldgvlpdgv
sdasrtsaddkwlplyllglyrvgrtqmpeyrkklmdgltnqckmineqfeplvpegrdi
fdvwgndsnytkivaavdmffhmfkkhecasfrygtivsrfkdcaalatfghlckitgms
tedvttwilnrevademvqmmlpgqeidkadsympylidfglsskspyssvknpafhfwg
qltalllrstrarnarqpddieytslttagllyayavgssadlaqqfcvgdnkytpdltt
nappqgrdvvewlgwfedqnrkptpdmmqyakravmslqglrektigkyaksefdk

SCOP Domain Coordinates for d2gicd1:

Click to download the PDB-style file with coordinates for d2gicd1.
(The format of our PDB-style files is described here.)

Timeline for d2gicd1: