![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.254: Nucleocapsid protein dimerization domain [103067] (1 superfamily) dimer of alpha-beta(2)-alpha motifs ; 2 layers, alpha/beta |
![]() | Superfamily d.254.1: Nucleocapsid protein dimerization domain [103068] (2 families) ![]() |
![]() | Family d.254.1.2: Coronavirus nucleocapsid protein [143508] (1 protein) C-terminal part of Pfam PF00937 |
![]() | Protein Coronavirus nucleocapsid protein [143509] (2 species) |
![]() | Species SARS coronavirus [TaxId:227859] [143511] (1 PDB entry) |
![]() | Domain d2gibb1: 2gib B:274-366 [135226] automatically matched to 2GIB A:270-366 complexed with so4 |
PDB Entry: 2gib (more details), 1.75 Å
SCOP Domain Sequences for d2gibb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gibb1 d.254.1.2 (B:274-366) Coronavirus nucleocapsid protein {SARS coronavirus [TaxId: 227859]} afgrrgpeqtqgnfgdqdlirqgtdykhwpqiaqfapsasaffgmsrigmevtpsgtwlt yhgaiklddkdpqfkdnvillnkhidayktfpp
Timeline for d2gibb1: