Lineage for d2giag_ (2gia G:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937473Fold d.18: ssDNA-binding transcriptional regulator domain [54446] (1 superfamily)
    helix-swapped dimer of beta(4)-alpha motifs
  4. 2937474Superfamily d.18.1: ssDNA-binding transcriptional regulator domain [54447] (5 families) (S)
  5. 2937514Family d.18.1.4: Guide RNA binding protein gBP [143043] (2 proteins)
    includes PfamB PB080318 and PB073991; forms heterooligomers; similar subunit and oligomeric structures to the Plant transcriptional regulator family
    automatically mapped to Pfam PF09387
  6. 2937524Protein Guide RNA binding protein gBP25 [143046] (1 species)
    Mitochondrial RNA-binding protein 2, MRP2
  7. 2937525Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [143047] (2 PDB entries)
    Uniprot Q952G2 56-221
  8. 2937527Domain d2giag_: 2gia G: [135224]
    Other proteins in same PDB: d2giab1, d2giad_
    automated match to d2giaa1
    complexed with acy

Details for d2giag_

PDB Entry: 2gia (more details), 1.89 Å

PDB Description: Crystal structures of trypanosoma bruciei MRP1/MRP2
PDB Compounds: (G:) mitochondrial RNA-binding protein 2

SCOPe Domain Sequences for d2giag_:

Sequence, based on SEQRES records: (download)

>d2giag_ d.18.1.4 (G:) Guide RNA binding protein gBP25 {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
kwrrpslaqqrarraqlppafdvvhwndedisrghllrvlhrdtfvvldyhrqarmltee
gnkaervvsvmlpavytarflavlegrsekvevhsrytnatftpnpaapytftlkctstr
paqqkqqvageegdetfewtvefdvaeslmlqrfltqalhyntgfar

Sequence, based on observed residues (ATOM records): (download)

>d2giag_ d.18.1.4 (G:) Guide RNA binding protein gBP25 {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
kwrrpslaqqrarraqlppafdvvhwndedisrghllrvlhrdtfvvldyhrqarmltee
gnkaervvsvmlpavytarflavlegrsekvevhsrytnatftpnpaapytftlkctstr
pdetfewtvefdvaeslmlqrfltqalhyntgfar

SCOPe Domain Coordinates for d2giag_:

Click to download the PDB-style file with coordinates for d2giag_.
(The format of our PDB-style files is described here.)

Timeline for d2giag_: