Lineage for d2giab1 (2gia B:28-173)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 856230Fold d.18: ssDNA-binding transcriptional regulator domain [54446] (1 superfamily)
    helix-swapped dimer of beta(4)-alpha motifs
  4. 856231Superfamily d.18.1: ssDNA-binding transcriptional regulator domain [54447] (4 families) (S)
  5. 856264Family d.18.1.4: Guide RNA binding protein gBP [143043] (2 proteins)
    includes PfamB PB080318 and PB073991; forms heterooligomers; similar subunit and oligomeric structures to the Plant transcriptional regulator family
  6. 856265Protein GBP21 [143044] (1 species)
    Mitochondrial RNA binding protein 1, MRP1
  7. 856266Species Trypanosoma brucei [TaxId:5691] [143045] (3 PDB entries)
    Uniprot P90629 28-173
  8. 856267Domain d2giab1: 2gia B:28-173 [135222]
    Other proteins in same PDB: d2giaa1, d2giag1
    complexed with acy

Details for d2giab1

PDB Entry: 2gia (more details), 1.89 Å

PDB Description: Crystal structures of trypanosoma bruciei MRP1/MRP2
PDB Compounds: (B:) mitochondrial RNA-binding protein 1

SCOP Domain Sequences for d2giab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2giab1 d.18.1.4 (B:28-173) GBP21 {Trypanosoma brucei [TaxId: 5691]}
slpkfeihdvrddpaegtmtrvavdgklllisqypqlgprkvdpndlspqfdadrrisvr
lrhvdlaylvgvckervprhrmetkaytldfeksaqgyhlhgkvhrvasqrmedwsvkfd
nhfavtlehflesaldesfgfrqhya

SCOP Domain Coordinates for d2giab1:

Click to download the PDB-style file with coordinates for d2giab1.
(The format of our PDB-style files is described here.)

Timeline for d2giab1: