Lineage for d2giaa1 (2gia A:56-221)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 719299Fold d.18: ssDNA-binding transcriptional regulator domain [54446] (1 superfamily)
    helix-swapped dimer of beta(4)-alpha motifs
  4. 719300Superfamily d.18.1: ssDNA-binding transcriptional regulator domain [54447] (4 families) (S)
  5. 719333Family d.18.1.4: Guide RNA binding protein gBP [143043] (2 proteins)
    includes PfamB 080318 and PB073991; forms heterooligomers; similar subunit and oligomeric structures to the Plant transcriptional regulator family
  6. 719343Protein Guide RNA binding protein gBP25 [143046] (1 species)
    Mitochondrial RNA-binding protein 2, MRP2
  7. 719344Species Trypanosoma brucei [TaxId:5691] [143047] (2 PDB entries)
  8. 719345Domain d2giaa1: 2gia A:56-221 [135221]
    Other proteins in same PDB: d2giab1, d2giad1
    complexed with acy

Details for d2giaa1

PDB Entry: 2gia (more details), 1.89 Å

PDB Description: Crystal structures of trypanosoma bruciei MRP1/MRP2
PDB Compounds: (A:) mitochondrial RNA-binding protein 2

SCOP Domain Sequences for d2giaa1:

Sequence, based on SEQRES records: (download)

>d2giaa1 d.18.1.4 (A:56-221) Guide RNA binding protein gBP25 {Trypanosoma brucei [TaxId: 5691]}
wrrpslaqqrarraqlppafdvvhwndedisrghllrvlhrdtfvvldyhrqarmlteeg
nkaervvsvmlpavytarflavlegrsekvevhsrytnatftpnpaapytftlkctstrp
aqqkqqvageegdetfewtvefdvaeslmlqrfltqalhyntgfar

Sequence, based on observed residues (ATOM records): (download)

>d2giaa1 d.18.1.4 (A:56-221) Guide RNA binding protein gBP25 {Trypanosoma brucei [TaxId: 5691]}
wrrpslaqqrarraqlppafdvvhwndedisrghllrvlhrdtfvvldyhrqarmlteeg
nkaervvsvmlpavytarflavlegrsekvevhsrytnatftpnpaapytftlkctstrp
detfewtvefdvaeslmlqrfltqalhyntgfar

SCOP Domain Coordinates for d2giaa1:

Click to download the PDB-style file with coordinates for d2giaa1.
(The format of our PDB-style files is described here.)

Timeline for d2giaa1: