Lineage for d2gi3a1 (2gi3 A:1-475)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150370Fold c.117: Amidase signature (AS) enzymes [75303] (1 superfamily)
    possible duplication: the topologies of N- and C-terminal halves are similar; 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213549A867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2150371Superfamily c.117.1: Amidase signature (AS) enzymes [75304] (1 family) (S)
    automatically mapped to Pfam PF01425
  5. 2150372Family c.117.1.1: Amidase signature (AS) enzymes [75305] (5 protein domains)
  6. 2150391Protein Glutamyl-tRNA(Gln) amidotransferase subunit A [142738] (3 species)
  7. 2150400Species Thermotoga maritima [TaxId:2336] [142740] (1 PDB entry)
    Uniprot Q9X0Z9 1-475
  8. 2150401Domain d2gi3a1: 2gi3 A:1-475 [135220]
    Other proteins in same PDB: d2gi3a2
    complexed with act, mpd

Details for d2gi3a1

PDB Entry: 2gi3 (more details), 1.8 Å

PDB Description: crystal structure of glutamyl-trna(gln) amidotransferase subunit a (tm1272) from thermotoga maritima at 1.80 a resolution
PDB Compounds: (A:) Glutamyl-tRNA(Gln) amidotransferase subunit A

SCOPe Domain Sequences for d2gi3a1:

Sequence, based on SEQRES records: (download)

>d2gi3a1 c.117.1.1 (A:1-475) Glutamyl-tRNA(Gln) amidotransferase subunit A {Thermotoga maritima [TaxId: 2336]}
midldfrkltieeclklseeereklpqlsletikrldphvkafisvrenvsvekkgkfwg
ipvaikdniltlgmrttcasrilenyesvfdatvvkkmkeagfvvvgkanldefamgsst
ersaffptrnpwdlervpggssggsaaavsagmvvaalgsdtggsvrqpaslcgvvgykp
tyglvsryglvafassldqigpitktvrdaailmeiisgrdendattvnrkvdflseiee
gvsgmkfavpeeiyehdieegvserfeealkllerlgakvervkiphikysvatyyviap
aeassnlarfdgvkyglrikekglremymktrnvgfgeevrrrimigtftlsaayyeayf
nkamkvrrkisdelnevlsqydailtptspvtafkigeikdpltyylmdiftipanlagl
paisvpfgfsnnlpvgvqvigrrfadgkvfriaraieknspynengmfplpevka

Sequence, based on observed residues (ATOM records): (download)

>d2gi3a1 c.117.1.1 (A:1-475) Glutamyl-tRNA(Gln) amidotransferase subunit A {Thermotoga maritima [TaxId: 2336]}
midldfrkltieeclklseeereklpqlsletikrldphvkafisvrenvsvekkgkfwg
ipvaikdniltlgmrttcasrilenyesvfdatvvkkmkeagfvvvgkanldefamgsst
ersaffptrnpwdlervpggssggsaaavsagmvvaalgsdtggsvrqpaslcgvvgykp
tyglvsryglvafassldqigpitktvrdaailmeiisgrdendattvnrkvdflseiee
gvsgmkfavpeeiyehdieegvserfeealkllerlgakvervkiphikysvatyyviap
aeassntrnvgfgeevrrrimigtftlsaayyeayfnkamkvrrkisdelnevlsqydai
ltptspvtafkigeikdpltyylmdiftipanlaglpaisvpfgfsnnlpvgvqvigrrf
adgkvfriaraieknspynengmfplpevka

SCOPe Domain Coordinates for d2gi3a1:

Click to download the PDB-style file with coordinates for d2gi3a1.
(The format of our PDB-style files is described here.)

Timeline for d2gi3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gi3a2