Lineage for d2ghyb1 (2ghy B:1-57)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640053Fold a.30: ROP-like [47379] (8 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 640054Superfamily a.30.1: ROP protein [47380] (1 family) (S)
  5. 640055Family a.30.1.1: ROP protein [47381] (1 protein)
  6. 640056Protein ROP protein [47382] (1 species)
  7. 640057Species Escherichia coli [TaxId:562] [47383] (11 PDB entries)
  8. 640065Domain d2ghyb1: 2ghy B:1-57 [135219]
    automatically matched to d1rpra_

Details for d2ghyb1

PDB Entry: 2ghy (more details), 2.5 Å

PDB Description: Novel Crystal Form of the ColE1 Rom Protein
PDB Compounds: (B:) Regulatory protein rop

SCOP Domain Sequences for d2ghyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ghyb1 a.30.1.1 (B:1-57) ROP protein {Escherichia coli [TaxId: 562]}
mtkqektalnmarfirsqtltlleklneldadeqadiceslhdhadelyrsclarfg

SCOP Domain Coordinates for d2ghyb1:

Click to download the PDB-style file with coordinates for d2ghyb1.
(The format of our PDB-style files is described here.)

Timeline for d2ghyb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ghya1