SCOPe 2.08: Domain d2ghyb_: 2ghy B:

Lineage for d2ghyb_ (2ghy B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.30: ROP-like [47379] (8 superfamilies)
   4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist

4. Superfamily a.30.1: ROP protein [47380] (1 family)
   automatically mapped to Pfam PF01815

5. Family a.30.1.1: ROP protein [47381] (1 protein)

6. Protein ROP protein [47382] (1 species)

7. Species Escherichia coli [TaxId:562] [47383] (18 PDB entries)
   Uniprot P03051

8. Domain d2ghyb_: 2ghy B: [135219]
   automated match to d1rpra_

Details for d2ghyb_

PDB Entry: 2ghy, 2.5 Å

PDB Description: Novel Crystal Form of the ColE1 Rom Protein

PDB Compounds: (B:) Regulatory protein rop

SCOPe Domain Sequences for d2ghyb_:

Sequence; same for both SEQRES and ATOM records:

>d2ghyb_ a.30.1.1 (B:) ROP protein {Escherichia coli [TaxId: 562]}
mtkqektalnmarfirsqtltlleklneldadeqadiceslhdhadelyrsclarfg

Timeline for d2ghyb_:

• d2ghyb_ first appeared in SCOP 1.73, called d2ghyb1
  
• d2ghyb_ appears in SCOPe 2.07