Lineage for d2ghya_ (2ghy A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2322230Fold a.30: ROP-like [47379] (8 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 2322231Superfamily a.30.1: ROP protein [47380] (1 family) (S)
    automatically mapped to Pfam PF01815
  5. 2322232Family a.30.1.1: ROP protein [47381] (1 protein)
  6. 2322233Protein ROP protein [47382] (1 species)
  7. 2322234Species Escherichia coli [TaxId:562] [47383] (17 PDB entries)
    Uniprot P03051
  8. 2322252Domain d2ghya_: 2ghy A: [135218]
    automated match to d1rpra_

Details for d2ghya_

PDB Entry: 2ghy (more details), 2.5 Å

PDB Description: Novel Crystal Form of the ColE1 Rom Protein
PDB Compounds: (A:) Regulatory protein rop

SCOPe Domain Sequences for d2ghya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ghya_ a.30.1.1 (A:) ROP protein {Escherichia coli [TaxId: 562]}
mtkqektalnmarfirsqtltlleklneldadeqadiceslhdhadelyrsclarfg

SCOPe Domain Coordinates for d2ghya_:

Click to download the PDB-style file with coordinates for d2ghya_.
(The format of our PDB-style files is described here.)

Timeline for d2ghya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ghyb_