SCOP 1.73: Domain d2ghya1: 2ghy A:1-57

Lineage for d2ghya1 (2ghy A:1-57)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.30: ROP-like [47379] (8 superfamilies)
   4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist

4. Superfamily a.30.1: ROP protein [47380] (1 family)

5. Family a.30.1.1: ROP protein [47381] (1 protein)

6. Protein ROP protein [47382] (1 species)

7. Species Escherichia coli [TaxId:562] [47383] (11 PDB entries)

8. Domain d2ghya1: 2ghy A:1-57 [135218]
   automatically matched to d1rpra_

Details for d2ghya1

PDB Entry: 2ghy, 2.5 Å

PDB Description: Novel Crystal Form of the ColE1 Rom Protein

PDB Compounds: (A:) Regulatory protein rop

SCOP Domain Sequences for d2ghya1:

Sequence; same for both SEQRES and ATOM records:

>d2ghya1 a.30.1.1 (A:1-57) ROP protein {Escherichia coli [TaxId: 562]}
mtkqektalnmarfirsqtltlleklneldadeqadiceslhdhadelyrsclarfg

Timeline for d2ghya1:

• d2ghya1 is new in SCOP 1.73
  
• d2ghya1 appears in SCOP 1.75
  
• d2ghya1 appears in the current release, SCOPe 2.08, called d2ghya_