Lineage for d2ghwc1 (2ghw C:320-502)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 741775Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily)
    core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542
  4. 741776Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family) (S)
  5. 741777Family d.318.1.1: SARS receptor-binding domain-like [143588] (1 protein)
    part of PfamB 000266
  6. 741778Protein Spike protein S1 [143589] (1 species)
  7. 741779Species SARS coronavirus [TaxId:227859] [143590] (4 PDB entries)
  8. 741786Domain d2ghwc1: 2ghw C:320-502 [135217]
    automatically matched to 2GHV C:320-502
    complexed with cl

Details for d2ghwc1

PDB Entry: 2ghw (more details), 2.3 Å

PDB Description: Crystal structure of SARS spike protein receptor binding domain in complex with a neutralizing antibody, 80R
PDB Compounds: (C:) Spike glycoprotein

SCOP Domain Sequences for d2ghwc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ghwc1 d.318.1.1 (C:320-502) Spike protein S1 {SARS coronavirus [TaxId: 227859]}
tnlcpfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklndlcf
snvyadsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynyk
yrylrhgklrpferdisnvpfspdgkpctppalncywplndygfytttgigyqpyrvvvl
sfe

SCOP Domain Coordinates for d2ghwc1:

Click to download the PDB-style file with coordinates for d2ghwc1.
(The format of our PDB-style files is described here.)

Timeline for d2ghwc1: