Lineage for d2ghwc1 (2ghw C:320-502)
- Root: SCOP 1.73
Class d: Alpha and beta proteins (a+b) [53931] (334 folds) 
Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily)
core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family) 
Family d.318.1.1: SARS receptor-binding domain-like [143588] (1 protein)
part of PfamB 000266Protein Spike protein S1 [143589] (1 species) Species SARS coronavirus [TaxId:227859] [143590] (4 PDB entries) 
Domain d2ghwc1: 2ghw C:320-502 [135217]
automatically matched to 2GHV C:320-502
complexed with cl
Details for d2ghwc1
PDB Entry: 2ghw (more details), 2.3 Å
PDB Description: Crystal structure of SARS spike protein receptor binding domain in complex with a neutralizing antibody, 80R
PDB Compounds: (C:) Spike glycoproteinSCOP Domain Sequences for d2ghwc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ghwc1 d.318.1.1 (C:320-502) Spike protein S1 {SARS coronavirus [TaxId: 227859]}
tnlcpfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklndlcf
snvyadsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynyk
yrylrhgklrpferdisnvpfspdgkpctppalncywplndygfytttgigyqpyrvvvl
sfe
SCOP Domain Coordinates for d2ghwc1:
Click to download the PDB-style file with coordinates for d2ghwc1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ghwc1:
- d2ghwc1 is new in SCOP 1.73
- d2ghwc1 appears in SCOP 1.75
- d2ghwc1 appears in the current release, SCOPe 2.08, called d2ghwc_
View in 3D
