SCOP 1.73: Domain d2ghwa1: 2ghw A:320-502

Lineage for d2ghwa1 (2ghw A:320-502)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily)
   core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542

4. Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family)

5. Family d.318.1.1: SARS receptor-binding domain-like [143588] (1 protein)
   part of PfamB 000266

6. Protein Spike protein S1 [143589] (1 species)

7. Species SARS coronavirus [TaxId:227859] [143590] (4 PDB entries)

8. Domain d2ghwa1: 2ghw A:320-502 [135216]
   automatically matched to 2GHV C:320-502
   complexed with cl

Details for d2ghwa1

PDB Entry: 2ghw, 2.3 Å

PDB Description: Crystal structure of SARS spike protein receptor binding domain in complex with a neutralizing antibody, 80R

PDB Compounds: (A:) Spike glycoprotein

SCOP Domain Sequences for d2ghwa1:

Sequence; same for both SEQRES and ATOM records:

>d2ghwa1 d.318.1.1 (A:320-502) Spike protein S1 {SARS coronavirus [TaxId: 227859]}
tnlcpfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklndlcf
snvyadsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynyk
yrylrhgklrpferdisnvpfspdgkpctppalncywplndygfytttgigyqpyrvvvl
sfe

Timeline for d2ghwa1:

• d2ghwa1 is new in SCOP 1.73
  
• d2ghwa1 appears in SCOP 1.75
  
• d2ghwa1 appears in the current release, SCOPe 2.08, called d2ghwa_