Lineage for d2ghve_ (2ghv E:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2616505Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily)
    core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542
  4. 2616506Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family) (S)
    automatically mapped to Pfam PF09408
  5. 2616507Family d.318.1.1: SARS receptor-binding domain-like [143588] (1 protein)
    part of PfamB PB000266
  6. 2616508Protein Spike protein S1 [143589] (4 species)
  7. 2616514Species SARS coronavirus [TaxId:227859] [143590] (14 PDB entries)
    Uniprot P59594 320-502! Uniprot P59594 321-512! Uniprot P59594 323-502
  8. 2616516Domain d2ghve_: 2ghv E: [135215]
    automated match to d2dd8s1

Details for d2ghve_

PDB Entry: 2ghv (more details), 2.2 Å

PDB Description: Crystal structure of SARS spike protein receptor binding domain
PDB Compounds: (E:) Spike glycoprotein

SCOPe Domain Sequences for d2ghve_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ghve_ d.318.1.1 (E:) Spike protein S1 {SARS coronavirus [TaxId: 227859]}
tnlcpfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklndlcf
snvyadsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynyk
yrylrhgklrpferdisnvpfspdgkpctppalncywplndygfytttgigyqpyrvvvl
sfe

SCOPe Domain Coordinates for d2ghve_:

Click to download the PDB-style file with coordinates for d2ghve_.
(The format of our PDB-style files is described here.)

Timeline for d2ghve_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ghvc1