SCOPe 2.03: Domain d2ghve_: 2ghv E:

Lineage for d2ghve_ (2ghv E:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily)
   core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542

4. Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family)
   automatically mapped to Pfam PF09408

5. Family d.318.1.1: SARS receptor-binding domain-like [143588] (1 protein)
   part of PfamB PB000266

6. Protein Spike protein S1 [143589] (1 species)

7. Species SARS coronavirus [TaxId:227859] [143590] (6 PDB entries)
   Uniprot P59594 320-502! Uniprot P59594 321-512! Uniprot P59594 323-502

8. Domain d2ghve_: 2ghv E: [135215]
   automated match to d2dd8s1

Details for d2ghve_

PDB Entry: 2ghv, 2.2 Å

PDB Description: Crystal structure of SARS spike protein receptor binding domain

PDB Compounds: (E:) Spike glycoprotein

SCOPe Domain Sequences for d2ghve_:

Sequence; same for both SEQRES and ATOM records:

>d2ghve_ d.318.1.1 (E:) Spike protein S1 {SARS coronavirus [TaxId: 227859]}
tnlcpfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklndlcf
snvyadsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynyk
yrylrhgklrpferdisnvpfspdgkpctppalncywplndygfytttgigyqpyrvvvl
sfe

Timeline for d2ghve_:

• d2ghve_ first appeared in SCOP 1.73, called d2ghve1
  
• d2ghve_ appears in SCOPe 2.02
  
• d2ghve_ appears in SCOPe 2.04
  
• d2ghve_ appears in the current release, SCOPe 2.08