Lineage for d2ghvc1 (2ghv C:320-502)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1231741Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily)
    core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542
  4. 1231742Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family) (S)
  5. 1231743Family d.318.1.1: SARS receptor-binding domain-like [143588] (1 protein)
    part of PfamB PB000266
  6. 1231744Protein Spike protein S1 [143589] (1 species)
  7. 1231745Species SARS coronavirus [TaxId:227859] [143590] (6 PDB entries)
    Uniprot P59594 320-502! Uniprot P59594 321-512! Uniprot P59594 323-502
  8. 1231746Domain d2ghvc1: 2ghv C:320-502 [135214]

Details for d2ghvc1

PDB Entry: 2ghv (more details), 2.2 Å

PDB Description: Crystal structure of SARS spike protein receptor binding domain
PDB Compounds: (C:) Spike glycoprotein

SCOPe Domain Sequences for d2ghvc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ghvc1 d.318.1.1 (C:320-502) Spike protein S1 {SARS coronavirus [TaxId: 227859]}
tnlcpfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklndlcf
snvyadsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynyk
yrylrhgklrpferdisnvpfspdgkpctppalncywplndygfytttgigyqpyrvvvl
sfe

SCOPe Domain Coordinates for d2ghvc1:

Click to download the PDB-style file with coordinates for d2ghvc1.
(The format of our PDB-style files is described here.)

Timeline for d2ghvc1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ghve_