Lineage for d2ghuc1 (2ghu C:1-241)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 715176Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 715177Superfamily d.3.1: Cysteine proteinases [54001] (16 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 715178Family d.3.1.1: Papain-like [54002] (25 proteins)
  6. 715371Protein Falcipain 2 [142846] (1 species)
  7. 715372Species Plasmodium falciparum [TaxId:5833] [142847] (2 PDB entries)
  8. 715376Domain d2ghuc1: 2ghu C:1-241 [135212]
    automatically matched to 1YVB A:0-212

Details for d2ghuc1

PDB Entry: 2ghu (more details), 3.1 Å

PDB Description: Crystal structure of falcipain-2 from Plasmodium falciparum
PDB Compounds: (C:) falcipain 2

SCOP Domain Sequences for d2ghuc1:

Sequence, based on SEQRES records: (download)

>d2ghuc1 d.3.1.1 (C:1-241) Falcipain 2 {Plasmodium falciparum [TaxId: 5833]}
qmnyeevikkyrgeenfdhaaydwrlhsgvtpvkdqkncgscwafssigsvesqyairkn
klitlseqelvdcsfknygcngglinnafedmielggicpdgdypyvsdapnlcnidrct
ekygiknylsvpdnklkealrflgpisisvavsddfafykegifdgecgdqlnhavmlvg
fgmkeivnpltkkgekhyyyiiknswgqqwgergfinietdesglmrkcglgtdafipli
e

Sequence, based on observed residues (ATOM records): (download)

>d2ghuc1 d.3.1.1 (C:1-241) Falcipain 2 {Plasmodium falciparum [TaxId: 5833]}
qmnyeevikkyrgnfdhaaydwrlhsgvtpvkdqkncgscwafssigsvesqyairknkl
itlseqelvdcsfknygcngglinnafedmielggicpdgdypyvsdapnlcnidrctek
ygiknylsvpdnklkealrflgpisisvavsddfafykegifdgecgdqlnhavmlvgfg
mkeivnpltkkgekhyyyiiknswgqqwgergfinietdesglmrkcglgtdafiplie

SCOP Domain Coordinates for d2ghuc1:

Click to download the PDB-style file with coordinates for d2ghuc1.
(The format of our PDB-style files is described here.)

Timeline for d2ghuc1: