SCOPe 2.06: Domain d2ghua_: 2ghu A:

Lineage for d2ghua_ (2ghu A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein Falcipain 2 [142846] (1 species)

7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [142847] (5 PDB entries)
   Uniprot Q9N6S8 244-484

8. Domain d2ghua_: 2ghu A: [135210]
   automated match to d2oula_

Details for d2ghua_

PDB Entry: 2ghu, 3.1 Å

PDB Description: Crystal structure of falcipain-2 from Plasmodium falciparum

PDB Compounds: (A:) falcipain 2

SCOPe Domain Sequences for d2ghua_:

Sequence; same for both SEQRES and ATOM records:

>d2ghua_ d.3.1.1 (A:) Falcipain 2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
qmnyeevikkyrgeenfdhaaydwrlhsgvtpvkdqkncgscwafssigsvesqyairkn
klitlseqelvdcsfknygcngglinnafedmielggicpdgdypyvsdapnlcnidrct
ekygiknylsvpdnklkealrflgpisisvavsddfafykegifdgecgdqlnhavmlvg
fgmkeivnpltkkgekhyyyiiknswgqqwgergfinietdesglmrkcglgtdafipli
e

Timeline for d2ghua_:

• d2ghua_ first appeared in SCOP 1.73, called d2ghua1
  
• d2ghua_ appears in SCOPe 2.05
  
• d2ghua_ appears in SCOPe 2.07
  
• d2ghua_ appears in the current release, SCOPe 2.08