Lineage for d2ghsa1 (2ghs A:20-314)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2398193Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2398879Superfamily b.68.6: Calcium-dependent phosphotriesterase [63829] (4 families) (S)
  5. 2398880Family b.68.6.1: SGL-like [63830] (4 protein domains)
  6. 2398908Protein Regucalcin [141548] (1 species)
    Agr_c_1268p/Atu0702
  7. 2398909Species Agrobacterium tumefaciens [TaxId:358] [141549] (1 PDB entry)
    Uniprot Q7D0W3 20-314
  8. 2398910Domain d2ghsa1: 2ghs A:20-314 [135209]
    complexed with cl, edo, k

Details for d2ghsa1

PDB Entry: 2ghs (more details), 1.55 Å

PDB Description: crystal structure of a calcium-binding protein, regucalcin (agr_c_1268) from agrobacterium tumefaciens str. c58 at 1.55 a resolution
PDB Compounds: (A:) AGR_C_1268p

SCOPe Domain Sequences for d2ghsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]}
latvfpfagrvldetpmllgegptfdpasgtawwfnilerelhelhlasgrktvhalpfm
gsalakisdskqliasddglflrdtatgvltlhaelesdlpgnrsndgrmhpsgalwigt
mgrkaetgagsiyhvakgkvtklfadisipnsicfspdgttgyfvdtkvnrlmrvpldar
tglptgkaevfidstgikggmdgsvcdaeghiwnarwgegavdrydtdgnhiaryevpgk
qttcpafigpdasrllvtsarehldddaitanpqhgltfelgievkgrfeplyrl

SCOPe Domain Coordinates for d2ghsa1:

Click to download the PDB-style file with coordinates for d2ghsa1.
(The format of our PDB-style files is described here.)

Timeline for d2ghsa1: