Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
Family c.23.16.8: HTS-like [142077] (2 proteins) Pfam PF04204 |
Protein Homoserine O-succinyltransferase HTS (MetA) [142078] (2 species) |
Species Bacillus cereus [TaxId:1396] [142079] (1 PDB entry) Uniprot Q72X44 17-297 |
Domain d2ghra1: 2ghr A:17-297 [135208] complexed with so4 |
PDB Entry: 2ghr (more details), 2.4 Å
SCOPe Domain Sequences for d2ghra1:
Sequence, based on SEQRES records: (download)
>d2ghra1 c.23.16.8 (A:17-297) Homoserine O-succinyltransferase HTS (MetA) {Bacillus cereus [TaxId: 1396]} eenifvmtkeraetqdiralkiailnlmptkqeteaqllrligntplqldvhllhmeshl srnvaqehltsfyktfrdienekfdgliitgapvetlsfeevdyweelkrimeysktnvt stlhicwgaqaglyhhygvqkyplkekmfgvfehevreqhvkllqgfdelffaphsrhte vresdirevkeltllanseeagvhlvigqegrqvfalghseyscdtlkqeyerdrdkgln idvpknyfkhdnpnekplvrwrshgnllfsnwlnyyvyqet
>d2ghra1 c.23.16.8 (A:17-297) Homoserine O-succinyltransferase HTS (MetA) {Bacillus cereus [TaxId: 1396]} eenifvmtkeraetqdiralkiailnlmptkqeteaqllrligntplqldvhllhmessf yktfrdienekfdgliitgapvetlsfeevdyweelkrimeysktnvtstlhicwgaqag lyhhygvqkyplkekmfgvfehevreqhvkllqgfdelffaphsrhtevresdirevkel tllanseeagvhlvigqegrqvfalghseyscdtlkqeyerdrdkglnidvpknyfkhdn pnekplvrwrshgnllfsnwlnyyvyqet
Timeline for d2ghra1: