Lineage for d2ghra1 (2ghr A:17-297)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2104318Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2104720Family c.23.16.8: HTS-like [142077] (2 protein domains)
    Pfam PF04204
  6. 2104721Protein Homoserine O-succinyltransferase HTS (MetA) [142078] (2 species)
  7. 2104722Species Bacillus cereus [TaxId:1396] [142079] (1 PDB entry)
    Uniprot Q72X44 17-297
  8. 2104723Domain d2ghra1: 2ghr A:17-297 [135208]
    complexed with so4

Details for d2ghra1

PDB Entry: 2ghr (more details), 2.4 Å

PDB Description: Crystal structure of homoserine o-succinyltransferase (NP_981826.1) from Bacillus cereus ATCC 10987 at 2.40 A resolution
PDB Compounds: (A:) Homoserine O-succinyltransferase

SCOPe Domain Sequences for d2ghra1:

Sequence, based on SEQRES records: (download)

>d2ghra1 c.23.16.8 (A:17-297) Homoserine O-succinyltransferase HTS (MetA) {Bacillus cereus [TaxId: 1396]}
eenifvmtkeraetqdiralkiailnlmptkqeteaqllrligntplqldvhllhmeshl
srnvaqehltsfyktfrdienekfdgliitgapvetlsfeevdyweelkrimeysktnvt
stlhicwgaqaglyhhygvqkyplkekmfgvfehevreqhvkllqgfdelffaphsrhte
vresdirevkeltllanseeagvhlvigqegrqvfalghseyscdtlkqeyerdrdkgln
idvpknyfkhdnpnekplvrwrshgnllfsnwlnyyvyqet

Sequence, based on observed residues (ATOM records): (download)

>d2ghra1 c.23.16.8 (A:17-297) Homoserine O-succinyltransferase HTS (MetA) {Bacillus cereus [TaxId: 1396]}
eenifvmtkeraetqdiralkiailnlmptkqeteaqllrligntplqldvhllhmessf
yktfrdienekfdgliitgapvetlsfeevdyweelkrimeysktnvtstlhicwgaqag
lyhhygvqkyplkekmfgvfehevreqhvkllqgfdelffaphsrhtevresdirevkel
tllanseeagvhlvigqegrqvfalghseyscdtlkqeyerdrdkglnidvpknyfkhdn
pnekplvrwrshgnllfsnwlnyyvyqet

SCOPe Domain Coordinates for d2ghra1:

Click to download the PDB-style file with coordinates for d2ghra1.
(The format of our PDB-style files is described here.)

Timeline for d2ghra1: