| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) ![]() |
| Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
| Protein U4/U6 snRNA-associated-splicing factor PRP24 [143338] (1 species) contains three RBDs |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [143339] (2 PDB entries) Uniprot P49960 116-196! Uniprot P49960 206-291! Uniprot P49960 41-115 |
| Domain d2ghpg2: 2ghp G:41-115 [135203] automated match to d2ghpa2 |
PDB Entry: 2ghp (more details), 2.7 Å
SCOPe Domain Sequences for d2ghpg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ghpg2 d.58.7.1 (G:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttvlvknlpksynqnkvykyfkhcgpiihvdvadslkknfrfariefarydgalaaitkt
hkvvgqneiivshlt
Timeline for d2ghpg2: