Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
Protein U4/U6 snRNA-associated-splicing factor PRP24 [143338] (1 species) contains three RBDs |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [143339] (2 PDB entries) Uniprot P49960 116-196! Uniprot P49960 206-291! Uniprot P49960 41-115 |
Domain d2ghpg1: 2ghp G:116-196 [135202] automated match to d2ghpa1 |
PDB Entry: 2ghp (more details), 2.7 Å
SCOPe Domain Sequences for d2ghpg1:
Sequence, based on SEQRES records: (download)
>d2ghpg1 d.58.7.1 (G:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ectlwmtnfppsytqrnirdllqdinvvalsirlpslrfntsrrfayidvtskedarycv eklnglkiegytlvtkvsnpl
>d2ghpg1 d.58.7.1 (G:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ectlwmtnfppsytqrnirdllqdinvvalsirlprrfayidvtskedarycveklnglk iegytlvtkvsnpl
Timeline for d2ghpg1: