| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) ![]() |
| Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
| Protein U4/U6 snRNA-associated-splicing factor PRP24 [143338] (1 species) contains three RBDs |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [143339] (2 PDB entries) Uniprot P49960 116-196! Uniprot P49960 206-291! Uniprot P49960 41-115 |
| Domain d2ghpb3: 2ghp B:206-291 [135189] automated match to d2ghpa3 |
PDB Entry: 2ghp (more details), 2.7 Å
SCOPe Domain Sequences for d2ghpb3:
Sequence, based on SEQRES records: (download)
>d2ghpb3 d.58.7.1 (B:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tlegreimirnlstelldenllresfegfgsiekinipagqkehsfnnccafmvfenkds
aeralqmnrsllgnreisvsladkkp
>d2ghpb3 d.58.7.1 (B:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tlegreimirnlstelldenllresfegfgsiekinipagqkfnnccafmvfenkdsaer
alqmnrsllgnreisvsladkkp
Timeline for d2ghpb3: