![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily) unusual fold; contains a left-handed beta-alpha-beta unit |
![]() | Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) ![]() automatically mapped to Pfam PF01000 |
![]() | Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (3 proteins) |
![]() | Protein RNA polymerase alpha subunit [56555] (3 species) |
![]() | Species Thermus aquaticus [TaxId:271] [64461] (4 PDB entries) |
![]() | Domain d2ghob2: 2gho B:50-172 [135183] Other proteins in same PDB: d2ghoa1, d2ghob1, d2ghoc1, d2ghod1 automatically matched to d1i6va2 protein/RNA complex |
PDB Entry: 2gho (more details), 5 Å
SCOPe Domain Sequences for d2ghob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ghob2 d.181.1.1 (B:50-172) RNA polymerase alpha subunit {Thermus aquaticus [TaxId: 271]} gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrfldpkmasttlilraegpkev ragdftpsadveimnpdlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvda ifs
Timeline for d2ghob2:
![]() Domains from other chains: (mouse over for more information) d2ghoa1, d2ghoa2, d2ghoc1, d2ghod1 |