SCOPe 2.02: Domain d2ghoa2: 2gho A:50-172

Lineage for d2ghoa2 (2gho A:50-172)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
   unusual fold; contains a left-handed beta-alpha-beta unit

4. Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family)

5. Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)

6. Protein RNA polymerase alpha subunit [56555] (3 species)

7. Species Thermus aquaticus [TaxId:271] [64461] (4 PDB entries)

8. Domain d2ghoa2: 2gho A:50-172 [135181]
   Other proteins in same PDB: d2ghoa1, d2ghob1, d2ghoc1, d2ghod1
   automatically matched to d1i6va2
   protein/RNA complex

Details for d2ghoa2

PDB Entry: 2gho, 5 Å

PDB Description: recombinant thermus aquaticus rna polymerase for structural studies

PDB Compounds: (A:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d2ghoa2:

Sequence; same for both SEQRES and ATOM records:

>d2ghoa2 d.181.1.1 (A:50-172) RNA polymerase alpha subunit {Thermus aquaticus [TaxId: 271]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrfldpkmasttlilraegpkev
ragdftpsadveimnpdlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvda
ifs

Timeline for d2ghoa2:

• d2ghoa2 first appeared in SCOP 1.73
  
• d2ghoa2 appears in SCOPe 2.01
  
• d2ghoa2 appears in SCOPe 2.03
  
• d2ghoa2 appears in the current release, SCOPe 2.08