![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
![]() | Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) ![]() form homo and heterodimers |
![]() | Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins) |
![]() | Protein RNA polymerase alpha [55259] (3 species) |
![]() | Species Thermus aquaticus [TaxId:271] [64314] (4 PDB entries) |
![]() | Domain d2ghoa1: 2gho A:6-49,A:173-231 [135180] Other proteins in same PDB: d2ghoa2, d2ghob2, d2ghoc1, d2ghod1 automatically matched to d1i6vb1 protein/RNA complex |
PDB Entry: 2gho (more details), 5 Å
SCOPe Domain Sequences for d2ghoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ghoa1 d.74.3.1 (A:6-49,A:173-231) RNA polymerase alpha {Thermus aquaticus [TaxId: 271]} lkapvftattqgdhygefvleplergfgvtlgnplrrillssipXpvrrvafqvedtrlg qrtdldkltlriwtdgsvtplealnqavailkehlnyfanpeas
Timeline for d2ghoa1:
![]() Domains from other chains: (mouse over for more information) d2ghob1, d2ghob2, d2ghoc1, d2ghod1 |