SCOP 1.73: Domain d2ghoa1: 2gho A:6-49,A:173-231

Lineage for d2ghoa1 (2gho A:6-49,A:173-231)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.74: DCoH-like [55247] (4 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families)
   form homo and heterodimers

5. Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)

6. Protein RNA polymerase alpha [55259] (3 species)

7. Species Thermus aquaticus [TaxId:271] [64314] (4 PDB entries)

8. Domain d2ghoa1: 2gho A:6-49,A:173-231 [135180]
   Other proteins in same PDB: d2ghoa2, d2ghob2
   automatically matched to d1i6vb1

Details for d2ghoa1

PDB Entry: 2gho, 5 Å

PDB Description: recombinant thermus aquaticus rna polymerase for structural studies

PDB Compounds: (A:) DNA-directed RNA polymerase alpha chain

SCOP Domain Sequences for d2ghoa1:

Sequence; same for both SEQRES and ATOM records:

>d2ghoa1 d.74.3.1 (A:6-49,A:173-231) RNA polymerase alpha {Thermus aquaticus [TaxId: 271]}
lkapvftattqgdhygefvleplergfgvtlgnplrrillssipXpvrrvafqvedtrlg
qrtdldkltlriwtdgsvtplealnqavailkehlnyfanpeas

Timeline for d2ghoa1:

• d2ghoa1 is new in SCOP 1.73
  
• d2ghoa1 appears in SCOP 1.75
  
• d2ghoa1 appears in the current release, SCOPe 2.08