SCOPe 2.08: Domain d2ghkx2: 2ghk X:2-250

Lineage for d2ghkx2 (2ghk X:2-250)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein Ascorbate peroxidase [48123] (3 species)

7. Species Soybean (Glycine max) [TaxId:3847] [89092] (15 PDB entries)
   Uniprot Q43758

8. Domain d2ghkx2: 2ghk X:2-250 [135179]
   Other proteins in same PDB: d2ghkx3
   automated match to d1oafa_
   complexed with cyn, hem, k

Details for d2ghkx2

PDB Entry: 2ghk, 2 Å

PDB Description: conformational mobility in the active site of a heme peroxidase

PDB Compounds: (X:) cytosolic ascorbate peroxidase 1

SCOPe Domain Sequences for d2ghkx2:

Sequence; same for both SEQRES and ATOM records:

>d2ghkx2 a.93.1.1 (X:2-250) Ascorbate peroxidase {Soybean (Glycine max) [TaxId: 3847]}
gksyptvsadyqkavekakkklrgfiaekrcaplmlrlawhsagtfdkgtktggpfgtik
hpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgred
kpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwts
nplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahqk
lselgfada

Timeline for d2ghkx2:

• d2ghkx2 first appeared in SCOP 1.73, called d2ghkx1
  
• d2ghkx2 appears in SCOPe 2.07