![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) ![]() |
![]() | Family a.93.1.1: CCP-like [48114] (5 proteins) |
![]() | Protein Ascorbate peroxidase [48123] (3 species) |
![]() | Species Soybean (Glycine max) [TaxId:3847] [89092] (15 PDB entries) Uniprot Q43758 |
![]() | Domain d2ghkx2: 2ghk X:2-250 [135179] Other proteins in same PDB: d2ghkx3 automated match to d1oafa_ complexed with cyn, hem, k |
PDB Entry: 2ghk (more details), 2 Å
SCOPe Domain Sequences for d2ghkx2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ghkx2 a.93.1.1 (X:2-250) Ascorbate peroxidase {Soybean (Glycine max) [TaxId: 3847]} gksyptvsadyqkavekakkklrgfiaekrcaplmlrlawhsagtfdkgtktggpfgtik hpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgred kpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwts nplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahqk lselgfada
Timeline for d2ghkx2: