Lineage for d2ghga1 (2ghg A:2-270)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2980339Protein Cell cycle checkpoint kinase chk1 [64404] (1 species)
    CaMK group; CAMKL subfamily; serine/threonine kinase
  7. 2980340Species Human (Homo sapiens) [TaxId:9606] [64405] (100 PDB entries)
  8. 2980446Domain d2ghga1: 2ghg A:2-270 [135177]
    automatically matched to d1ia8a_
    complexed with a53

Details for d2ghga1

PDB Entry: 2ghg (more details), 3.5 Å

PDB Description: h-CHK1 complexed with A431994
PDB Compounds: (A:) Serine/threonine-protein kinase Chk1

SCOPe Domain Sequences for d2ghga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ghga1 d.144.1.7 (A:2-270) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]}
avpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicinkm
lnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvyl
hgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkr
refhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplal
lhkilvenpsaritipdikkdrwynkplk

SCOPe Domain Coordinates for d2ghga1:

Click to download the PDB-style file with coordinates for d2ghga1.
(The format of our PDB-style files is described here.)

Timeline for d2ghga1: