Class b: All beta proteins [48724] (165 folds) |
Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) |
Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins) |
Protein Streptavidin [50878] (1 species) |
Species Streptomyces avidinii [TaxId:1895] [50879] (117 PDB entries) |
Domain d2gh7b1: 2gh7 B:16-134 [135174] automatically matched to d1hy2a_ complexed with btn, btq, gol |
PDB Entry: 2gh7 (more details), 1 Å
SCOP Domain Sequences for d2gh7b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gh7b1 b.61.1.1 (B:16-134) Streptavidin {Streptomyces avidinii [TaxId: 1895]} gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk
Timeline for d2gh7b1: