SCOP 1.73: Domain d2gh7b1: 2gh7 B:16-134

Lineage for d2gh7b1 (2gh7 B:16-134)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (1 family)

5. Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (117 PDB entries)

8. Domain d2gh7b1: 2gh7 B:16-134 [135174]
   automatically matched to d1hy2a_
   complexed with btn, btq, gol

Details for d2gh7b1

PDB Entry: 2gh7, 1 Å

PDB Description: Epi-biotin complex with core streptavidin

PDB Compounds: (B:) streptavidin

SCOP Domain Sequences for d2gh7b1:

Sequence; same for both SEQRES and ATOM records:

>d2gh7b1 b.61.1.1 (B:16-134) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk

Timeline for d2gh7b1:

• d2gh7b1 is new in SCOP 1.73
  
• d2gh7b1 appears in SCOP 1.75
  
• d2gh7b1 appears in the current release, SCOPe 2.08, called d2gh7b_