![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
![]() | Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) ![]() |
![]() | Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins) |
![]() | Protein Streptavidin [50878] (1 species) |
![]() | Species Streptomyces avidinii [TaxId:1895] [50879] (128 PDB entries) |
![]() | Domain d2gh7b_: 2gh7 B: [135174] automated match to d1n9mc_ complexed with btn, btq, gol |
PDB Entry: 2gh7 (more details), 1 Å
SCOPe Domain Sequences for d2gh7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gh7b_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]} gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp
Timeline for d2gh7b_: