SCOP 1.75: Domain d2gh7a1: 2gh7 A:14-134

Lineage for d2gh7a1 (2gh7 A:14-134)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (1 family)

5. Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (118 PDB entries)

8. Domain d2gh7a1: 2gh7 A:14-134 [135173]
   automatically matched to d1hy2a_
   complexed with btn, btq, gol

Details for d2gh7a1

PDB Entry: 2gh7, 1 Å

PDB Description: Epi-biotin complex with core streptavidin

PDB Compounds: (A:) streptavidin

SCOP Domain Sequences for d2gh7a1:

Sequence; same for both SEQRES and ATOM records:

>d2gh7a1 b.61.1.1 (A:14-134) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
eagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtal
gwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv
k

Timeline for d2gh7a1:

• d2gh7a1 first appeared in SCOP 1.73
  
• d2gh7a1 is called d2gh7a_ in SCOPe 2.01
  
• d2gh7a1 appears in the current release, SCOPe 2.08, called d2gh7a_