Lineage for d2gh7a1 (2gh7 A:14-134)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 674116Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 674117Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 674118Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 674147Protein Streptavidin [50878] (1 species)
  7. 674148Species Streptomyces avidinii [TaxId:1895] [50879] (117 PDB entries)
  8. 674153Domain d2gh7a1: 2gh7 A:14-134 [135173]
    automatically matched to d1hy2a_
    complexed with btn, btq, gol

Details for d2gh7a1

PDB Entry: 2gh7 (more details), 1 Å

PDB Description: Epi-biotin complex with core streptavidin
PDB Compounds: (A:) streptavidin

SCOP Domain Sequences for d2gh7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gh7a1 b.61.1.1 (A:14-134) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
eagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtal
gwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv
k

SCOP Domain Coordinates for d2gh7a1:

Click to download the PDB-style file with coordinates for d2gh7a1.
(The format of our PDB-style files is described here.)

Timeline for d2gh7a1: