SCOPe 2.03: Domain d2gh2a_: 2gh2 A:

Lineage for d2gh2a_ (2gh2 A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 proteins)
   Pfam PF05995, CDO_I

6. Protein Cysteine dioxygenase type I [141616] (4 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [159291] (20 PDB entries)

8. Domain d2gh2a_: 2gh2 A: [135172]
   automated match to d2atfa1
   complexed with fe, so4

Details for d2gh2a_

PDB Entry: 2gh2, 1.5 Å

PDB Description: 1.5 a resolution r. norvegicus cysteine dioxygenase structure crystallized in the presence of cysteine

PDB Compounds: (A:) Cysteine dioxygenase type I

SCOPe Domain Sequences for d2gh2a_:

Sequence; same for both SEQRES and ATOM records:

>d2gh2a_ b.82.1.19 (A:) Cysteine dioxygenase type I {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytrnlvd
qgngkfnlmilcwgeghgssihdhtdshcflkllqgnlketlfdwpdkksnemikksert
lrenqcayindsiglhrvenvshtepavslhlysppfdtchafdqrtghknkvtmtfhsk
fgirtp

Timeline for d2gh2a_:

• d2gh2a_ first appeared in SCOP 1.73, called d2gh2a1
  
• d2gh2a_ appears in SCOPe 2.02
  
• d2gh2a_ appears in SCOPe 2.04
  
• d2gh2a_ appears in the current release, SCOPe 2.08