Lineage for d2gh2a_ (2gh2 A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1138044Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1138045Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 1138494Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 proteins)
    Pfam PF05995, CDO_I
  6. 1138495Protein Cysteine dioxygenase type I [141616] (4 species)
  7. 1138501Species Norway rat (Rattus norvegicus) [TaxId:10116] [159291] (3 PDB entries)
  8. 1138504Domain d2gh2a_: 2gh2 A: [135172]
    automated match to d2atfa1
    complexed with fe, so4

Details for d2gh2a_

PDB Entry: 2gh2 (more details), 1.5 Å

PDB Description: 1.5 a resolution r. norvegicus cysteine dioxygenase structure crystallized in the presence of cysteine
PDB Compounds: (A:) Cysteine dioxygenase type I

SCOPe Domain Sequences for d2gh2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gh2a_ b.82.1.19 (A:) Cysteine dioxygenase type I {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytrnlvd
qgngkfnlmilcwgeghgssihdhtdshcflkllqgnlketlfdwpdkksnemikksert
lrenqcayindsiglhrvenvshtepavslhlysppfdtchafdqrtghknkvtmtfhsk
fgirtp

SCOPe Domain Coordinates for d2gh2a_:

Click to download the PDB-style file with coordinates for d2gh2a_.
(The format of our PDB-style files is described here.)

Timeline for d2gh2a_: