Lineage for d2gh1b1 (2gh1 B:13-293)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 704539Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 704540Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families) (S)
  5. 705241Family c.66.1.49: BC2162-like [142629] (1 protein)
    contains extra helical regions inserted after strands 5 and 6 of the canonical fold
  6. 705242Protein Methyltransferase BC2162 [142630] (1 species)
  7. 705243Species Bacillus cereus [TaxId:1396] [142631] (1 PDB entry)
  8. 705245Domain d2gh1b1: 2gh1 B:13-293 [135171]
    automatically matched to 2GH1 A:13-293
    complexed with act, gol

Details for d2gh1b1

PDB Entry: 2gh1 (more details), 2.5 Å

PDB Description: crystal structure of the putative sam-dependent methyltransferase bc2162 from bacillus cereus, northeast structural genomics target bcr20.
PDB Compounds: (B:) Methyltransferase

SCOP Domain Sequences for d2gh1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gh1b1 c.66.1.49 (B:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]}
ylkntrdlyynddyvsflvntvwkitkpvhivdygcgygylglvlmpllpegskytgids
getllaearelfrllpydseflegdateielndkydiaichafllhmttpetmlqkmihs
vkkggkiicfephwisnmasylldgekqsefiqlgvlqklfesdtqrngkdgnigmkipi
ylselgvkniecrvsdkvnfldsnmhhndkndlyqslkeegiagdpgdkqqfverliarg
ltydnalaqyeaelrffkalhlhsslvyapnmkitfgeiec

SCOP Domain Coordinates for d2gh1b1:

Click to download the PDB-style file with coordinates for d2gh1b1.
(The format of our PDB-style files is described here.)

Timeline for d2gh1b1: