![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families) ![]() |
![]() | Family c.66.1.49: BC2162-like [142629] (1 protein) contains extra helical regions inserted after strands 5 and 6 of the canonical fold |
![]() | Protein Methyltransferase BC2162 [142630] (1 species) |
![]() | Species Bacillus cereus [TaxId:1396] [142631] (1 PDB entry) |
![]() | Domain d2gh1a1: 2gh1 A:13-293 [135170] complexed with act, gol |
PDB Entry: 2gh1 (more details), 2.5 Å
SCOP Domain Sequences for d2gh1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} ylkntrdlyynddyvsflvntvwkitkpvhivdygcgygylglvlmpllpegskytgids getllaearelfrllpydseflegdateielndkydiaichafllhmttpetmlqkmihs vkkggkiicfephwisnmasylldgekqsefiqlgvlqklfesdtqrngkdgnigmkipi ylselgvkniecrvsdkvnfldsnmhhndkndlyqslkeegiagdpgdkqqfverliarg ltydnalaqyeaelrffkalhlhsslvyapnmkitfgeiec
Timeline for d2gh1a1: