SCOP 1.73: Domain d2gh1a1: 2gh1 A:13-293

Lineage for d2gh1a1 (2gh1 A:13-293)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families)

5. Family c.66.1.49: BC2162-like [142629] (1 protein)
   contains extra helical regions inserted after strands 5 and 6 of the canonical fold

6. Protein Methyltransferase BC2162 [142630] (1 species)

7. Species Bacillus cereus [TaxId:1396] [142631] (1 PDB entry)

8. Domain d2gh1a1: 2gh1 A:13-293 [135170]
   complexed with act, gol

Details for d2gh1a1

PDB Entry: 2gh1, 2.5 Å

PDB Description: crystal structure of the putative sam-dependent methyltransferase bc2162 from bacillus cereus, northeast structural genomics target bcr20.

PDB Compounds: (A:) Methyltransferase

SCOP Domain Sequences for d2gh1a1:

Sequence; same for both SEQRES and ATOM records:

>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]}
ylkntrdlyynddyvsflvntvwkitkpvhivdygcgygylglvlmpllpegskytgids
getllaearelfrllpydseflegdateielndkydiaichafllhmttpetmlqkmihs
vkkggkiicfephwisnmasylldgekqsefiqlgvlqklfesdtqrngkdgnigmkipi
ylselgvkniecrvsdkvnfldsnmhhndkndlyqslkeegiagdpgdkqqfverliarg
ltydnalaqyeaelrffkalhlhsslvyapnmkitfgeiec

Timeline for d2gh1a1:

• d2gh1a1 is new in SCOP 1.73
  
• d2gh1a1 appears in SCOP 1.75
  
• d2gh1a1 appears in the current release, SCOPe 2.08