Lineage for d2ggxc2 (2ggx C:205-234)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2265467Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2265468Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family) (S)
  5. 2265469Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins)
  6. 2265541Protein Surfactant protein [57949] (2 species)
  7. 2265542Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (24 PDB entries)
  8. 2265593Domain d2ggxc2: 2ggx C:205-234 [135169]
    Other proteins in same PDB: d2ggxa1, d2ggxb1, d2ggxc1
    complexed with ca, npj

Details for d2ggxc2

PDB Entry: 2ggx (more details), 1.9 Å

PDB Description: crystal structure of the trimer neck and carbohydrate recognition domain of human surfactant protein d in complex with p-nitrophenyl maltoside
PDB Compounds: (C:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d2ggxc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ggxc2 h.1.1.1 (C:205-234) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]}
aslrqqvealqgqvqhlqaafsqykkvelf

SCOPe Domain Coordinates for d2ggxc2:

Click to download the PDB-style file with coordinates for d2ggxc2.
(The format of our PDB-style files is described here.)

Timeline for d2ggxc2: