Lineage for d2ggxb1 (2ggx B:235-355)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3002276Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 3002277Protein automated matches [190159] (21 species)
    not a true protein
  7. 3002332Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries)
  8. 3002545Domain d2ggxb1: 2ggx B:235-355 [135166]
    Other proteins in same PDB: d2ggxa2, d2ggxb2, d2ggxc2
    complexed with ca, npj

Details for d2ggxb1

PDB Entry: 2ggx (more details), 1.9 Å

PDB Description: crystal structure of the trimer neck and carbohydrate recognition domain of human surfactant protein d in complex with p-nitrophenyl maltoside
PDB Compounds: (B:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d2ggxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ggxb1 d.169.1.0 (B:235-355) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls
mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce
f

SCOPe Domain Coordinates for d2ggxb1:

Click to download the PDB-style file with coordinates for d2ggxb1.
(The format of our PDB-style files is described here.)

Timeline for d2ggxb1: