SCOPe 2.08: Domain d2ggxb1: 2ggx B:235-355

Lineage for d2ggxb1 (2ggx B:235-355)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (21 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries)

8. Domain d2ggxb1: 2ggx B:235-355 [135166]
   Other proteins in same PDB: d2ggxa2, d2ggxb2, d2ggxc2
   complexed with ca, npj

Details for d2ggxb1

PDB Entry: 2ggx, 1.9 Å

PDB Description: crystal structure of the trimer neck and carbohydrate recognition domain of human surfactant protein d in complex with p-nitrophenyl maltoside

PDB Compounds: (B:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d2ggxb1:

Sequence; same for both SEQRES and ATOM records:

>d2ggxb1 d.169.1.0 (B:235-355) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls
mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce
f

Timeline for d2ggxb1:

• d2ggxb1 first appeared in SCOP 1.73
  
• d2ggxb1 appears in SCOPe 2.07