Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family) |
Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins) |
Protein Surfactant protein [57949] (3 species) |
Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (26 PDB entries) |
Domain d2ggxa2: 2ggx A:205-234 [135165] Other proteins in same PDB: d2ggxa1, d2ggxb1, d2ggxc1 complexed with ca, npj |
PDB Entry: 2ggx (more details), 1.9 Å
SCOPe Domain Sequences for d2ggxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ggxa2 h.1.1.1 (A:205-234) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]} aslrqqvealqgqvqhlqaafsqykkvelf
Timeline for d2ggxa2:
View in 3D Domains from other chains: (mouse over for more information) d2ggxb1, d2ggxb2, d2ggxc1, d2ggxc2 |