SCOP 1.75: Domain d2ggub2: 2ggu B:205-235

Lineage for d2ggub2 (2ggu B:205-235)

1. Root: SCOP 1.75

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family)

5. Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins)

6. Protein Surfactant protein [57949] (2 species)

7. Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (15 PDB entries)

8. Domain d2ggub2: 2ggu B:205-235 [135161]
   Other proteins in same PDB: d2ggua1, d2ggub1, d2gguc1
   automatically matched to d1m7la_
   complexed with ca, mlr

Details for d2ggub2

PDB Entry: 2ggu, 1.9 Å

PDB Description: crystal structure of the trimeric neck and carbohydrate recognition domain of human surfactant protein d in complex with maltotriose

PDB Compounds: (B:) Pulmonary surfactant-associated protein D

SCOP Domain Sequences for d2ggub2:

Sequence; same for both SEQRES and ATOM records:

>d2ggub2 h.1.1.1 (B:205-235) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]}
aslrqqvealqgqvqhlqaafsqykkvelfp

Timeline for d2ggub2:

• d2ggub2 first appeared in SCOP 1.73
  
• d2ggub2 appears in SCOPe 2.01
  
• d2ggub2 appears in the current release, SCOPe 2.08