| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.1: Parallel coiled-coil [57943] (35 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family) ![]() |
| Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins) |
| Protein Surfactant protein [57949] (2 species) |
| Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (24 PDB entries) |
| Domain d2ggua2: 2ggu A:205-234 [135159] Other proteins in same PDB: d2ggua1, d2ggub1, d2gguc1 complexed with ca, mlr |
PDB Entry: 2ggu (more details), 1.9 Å
SCOPe Domain Sequences for d2ggua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ggua2 h.1.1.1 (A:205-234) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]}
aslrqqvealqgqvqhlqaafsqykkvelf
Timeline for d2ggua2:
View in 3DDomains from other chains: (mouse over for more information) d2ggub1, d2ggub2, d2gguc1, d2gguc2 |